PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 361aa    MW: 41377 Da    PI: 6.6445
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001520.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l d+++++G g+W+t ++  g+ R++k+c++rw +yl
      Pbr001520.1 14 KGPWTPEEDQKLMDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.74.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      Pbr001520.1  67 RGRFSFEEEETIIQLHIILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425.325965IPR017930Myb domain
SuperFamilySSF466891.68E-3111108IPR009057Homeodomain-like
SMARTSM007177.0E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001673.94E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.88466116IPR017930Myb domain
SMARTSM007173.5E-1666114IPR001005SANT/Myb domain
PfamPF002493.6E-1567111IPR001005SANT/Myb domain
CDDcd001673.98E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTPE EDQKLMDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHIILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDFSSILY NSSHHHHQMN NFSRLLGQPI GLNPELLRLA TLIQSHRESN  180
SNQNFVLQNA QENDYHQICN PQIQVSSQVQ SNQLQQPIQH NVPYPNEAAQ IMQLQPNVEY  240
PSSLSDFRSQ ISQLNEWQSN AGTSNFTEEY VDLPSFAYFG SEQNQTVLDL SPETSNIHSN  300
NSNQNFSFTS VFSTPSSSPT PMNSNSTTYF NSGTEDERES YCSNMLKFDI PSILDVNEFM  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5076711e-118AY507671.1 Malus x domestica putative MYB transcription factor (MYB) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009348003.10.0PREDICTED: protein ODORANT1-like
TrEMBLD9ZJ640.0D9ZJ64_MALDO; MYB domain class transcription factor
STRINGVIT_00s0203g00070.t011e-148(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-105MYB-like 102